Labprice Logo
Menu


ADH1B antibody
id: LP-70R-1271

Labprice ADH1B antibody

Fitzgerald


Description: Rabbit polyclonal ADH1B antibody

"Category: Purified Polyclonal Antibodies"
"Research Area: Proteases, Inhibitors, & Enzymes"
"Immunogen: ADH1B antibody was raised using a synthetic peptide corresponding to a region with amino acids NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV"
"Host: Rabbit"
"Specificity: NA"
"Cross Reactivity: Human"
"Isotype: NA"
"Clone: NA"
"Method of Purification: Total IgG Protein A purified"
"Concentration: 1 mg/ml"
"Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose."
"Applications: WB, IHC"
"Usage Recommendations: WB: 1.25 ug/ml
IHC: 4-8 ug/ml"

"Storage: Store at 2-8C for short periods. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles."
"Shipping: Blue Ice"


Size


InStock