Labprice Logo
Menu


WNT6 antibody
id: LP-70R-7182

Labprice WNT6 antibody

Fitzgerald


Description: Rabbit polyclonal WNT6 antibody raised against the middle region of WNT6

"Category: Purified Polyclonal Antibodies"
"Research Area: Signal Transduction"
"Immunogen: WNT6 antibody was raised using the middle region of WNT6 corresponding to a region with amino acids ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG"
"Host: Rabbit"
"Specificity: WNT6 antibody was raised against the middle region of WNT6"
"Cross Reactivity: Human,Mouse,Rat"
"Isotype: NA"
"Clone: NA"
"Method of Purification: Affinity purified"
"Concentration: 1 mg/ml"
"Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose."
"Applications: WB"
"Usage Recommendations: WB: 1 ug/ml"

"Storage: Store at 2-8C for short periods. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles."
"Shipping: Blue Ice"


Size


InStock