Labprice Autophagy protein 4A Recombinant Protein
ProSci
Description: Cysteine Protease ATG4A (ATG4A) is a cytoplasmic protein that belongs to the peptidase C54 family. ATG4A is widely expressed in many tissues at a low level, but the highest expression is observed in skeletal muscle and brain. ATG4A is a cysteine protease required for autophagy; it cleaves the C-terminal part of MAP1LC3, GABARAPL2 or GABARAP. ATG4A is inhibited by N-ethylmaleimide. It is suggested that ATG4A has a significant role in suppressing various cancers.
Tested Applications: N/A
Applications: This recombinant protein can be used for biological assays. For research use only.
Predicted Molecular Weight: 47.5 kD
Physical state: Liquid
Buffer: Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl?pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Concentration: N/A
NCBI official symbol: ATG4A
Accession #: Q8WYN0
Protein GI: 158257574
NCBI gene ID#: 115201
NCBI official full name: autophagy related 4A cysteine peptidase
NCBI organism: Homo sapiens
Peptide sequence: MGSSHHHHHHSSGLVPRGSHMESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
SWISSPROT #: Q8WYN0
Background Reference 1: N/A
Background Reference 2: N/A
Background Reference 3: N/A
Background Reference 4: N/A
Background Reference 5: N/A
Source: E. coli
Species: Human
By Source: E. Coli
By Species: Human
Fusion tag: N-6 His tag
Sequence: Met1-Val398
Biology activity: N/A
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Did you look for something else?
Semaphorin 4A Recombinant Protein
Semaphorin-4A Recombinant Protein
Semaphorin 4A Recombinant Protein
MAG / Siglec-4a Recombinant Protein
MAG / Siglec-4a Recombinant Protein
beta-Defensin 4A Recombinant Protein
IGHD4OR15-4A Recombinant Protein (Human)
Tubulin Beta-4A Chain Recombinant Protein
Recombinant Human Siglec-4a/MAG Protein
Recombinant Human Semaphorin-4A/SEMA4A Protein
OPCA03175-100UG - Oxyopinin-4a Recombinant Protein
OPCA03175-1MG - Oxyopinin-4a Recombinant Protein
OPCA03175-20UG - Oxyopinin-4a Recombinant Protein
Chromatin Modifying Protein 4A Human Recombinant
CHMP4A Chromatin Modifying Protein 4A Human Recombinant Protein
Semaphorin 4A Recombinant Protein His Tag Lyophilized
TXNL4A Thioredoxin-Like 4A Human Recombinant Protein
UBL4A Ubiquitin-Like 4A Human Recombinant Protein
Recombinant Human β-Defensin 4A/DEFB4A Protein
Recombinant Human β-Defensin 4A/DEFB4A Protein
Recombinant Human Vacuolar protein sorting-associated protein 4A (VPS4A)
Chromatin Modifying Protein 4A Protein
Chromatin Modifying Protein 4A Protein
Chromatin Modifying Protein 4A Protein