
Labprice Protein FAM3C Recombinant Protein
ProSci
Description: FAM3C, also called interleukin-like EMT inducer, usually exist in most secretory epithelia. It belongs to the FAM3 family according to their sequence similarities. The up-regulation and/or mislocalization in breast cancer and liver carcinoma cells of FAM3C is strongly correlated with metastasis formation and survival. FAM3C can be involved in retinal laminar formation and promote epithelial to mesenchymal transition.
Tested Applications: N/A
Applications: This recombinant protein can be used for biological assays. For research use only.
Predicted Molecular Weight: 23.2 kD
Physical state: Lyophilized
Buffer: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
Concentration: N/A
NCBI official symbol: FAM3C
Accession #: Q92520
Protein GI: N/A
NCBI gene ID#: 10447
NCBI official full name: family with sequence similarity 3 member C
NCBI organism: Homo sapiens
Peptide sequence: QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQDVDHHHHHH
SWISSPROT #: Q92520
Background Reference 1: N/A
Background Reference 2: N/A
Background Reference 3: N/A
Background Reference 4: N/A
Background Reference 5: N/A
Source: Human Cells
Species: Human
By Source: Human Cells
By Species: Human
Fusion tag: C-6 His tag
Sequence: Gln25-Asp227
Biology activity: N/A
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Did you look for something else?
FAM3C Recombinant Protein (Rat)
FAM3C Recombinant Protein (Human)
FAM3C Recombinant Protein (Mouse)
Human Protein FAM3C (FAM3C) ELISA Kit
Human Protein FAM3C(FAM3C) ELISA kit
Human Protein FAM3C(FAM3C) ELISA kit
Mouse Protein FAM3C(FAM3C) ELISA kit
Mouse Protein FAM3C(FAM3C) ELISA kit
Human Protein FAM3C, FAM3C ELISA KIT
Bovine Protein FAM3C, FAM3C ELISA KIT
Mouse Protein FAM3C, Fam3c ELISA KIT
Recombinant Human FAM3C Protein, His, E.coli-10ug