Labprice Logo
Menu


Galectin-Related Protein Recombinant Protein
id: LP-92-049

Labprice Galectin-Related Protein Recombinant Protein

ProSci


Description: Galectin-Related Protein (LGALSL) is a 172 amino acid protein that contains one Galectin domain. LGALSL does not appear to bind carbohydrates or lactose as the critical residues required for binding are not conserved. LGALSL may play a significant role in stimulating smooth muscle growth in developing alveolar wall vessels and the development of pulmonary capillaries.

Tested Applications: N/A
Applications: This recombinant protein can be used for biological assays. For research use only.
Predicted Molecular Weight: 20 kD
Physical state: Liquid
Buffer: Supplied as a 0.2 um filtered solution of 20mM Tris, 100mM NaCl, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Concentration: N/A
NCBI official symbol: LGALSL
Accession #: Q3ZCW2
Protein GI: N/A
NCBI gene ID#: 29094
NCBI official full name: lectin, galactoside-binding-like
NCBI organism: Homo sapiens
Peptide sequence: AGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLGLEHHHHHH
SWISSPROT #: Q3ZCW2
Background Reference 1: N/A
Background Reference 2: N/A
Background Reference 3: N/A
Background Reference 4: N/A
Background Reference 5: N/A
Source: E. coli
Species: Human
By Source: E. Coli
By Species: Human
Fusion tag: C-6 His tag
Sequence: Ala2-Ser172
Biology activity: N/A
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.


Size


InStock