Labprice Logo
Menu


Protein FAM3D Recombinant Protein
id: LP-91-318

Labprice Protein FAM3D Recombinant Protein

ProSci


Description: Protein FAM3D is a novel cytokine-like protein that belongs to the FAM3 family. Human FAM3D is synthesized as a 224 amino acid precursor that contains a 25 amino acid signal sequence and a 199 amino acid mature chain. FAM3D is identified based on structural, but not sequence, homology to short chain cytokines including IL-2, IL-4 and GM-CSF. FAM3 proteins are four helix bundle cytokines with four conserved cysteines in all members (FAM3A-D). FAM3B is highly expressed in alpha and beta cells of the pancreas and is being investigated as a potential contributor to beta cell death and development of Type I Diabetes.

Tested Applications: N/A
Applications: This recombinant protein can be used for biological assays. For research use only.
Predicted Molecular Weight: 23.12 kD
Physical state: Liquid
Buffer: Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Concentration: N/A
NCBI official symbol: FAM3D
Accession #: Q96BQ1
Protein GI: N/A
NCBI gene ID#: 131177
NCBI official full name: family with sequence similarity 3 member D
NCBI organism: Homo sapiens
Peptide sequence: YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPFVDHHHHHH
SWISSPROT #: Q96BQ1
Background Reference 1: N/A
Background Reference 2: N/A
Background Reference 3: N/A
Background Reference 4: N/A
Background Reference 5: N/A
Source: Human Cells
Species: Human
By Source: Human Cells
By Species: Human
Fusion tag: C-6 His tag
Sequence: Tyr26-Phe224
Biology activity: N/A
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.


Size


InStock