Labprice Logo
Menu


Autophagy protein 3 Recombinant Protein
id: LP-91-995

Labprice Autophagy protein 3 Recombinant Protein

ProSci


Description: Ubiquitin-Like-Conjugating Enzyme ATG3 (ATG3) is widely expressed and has highly levels in heart, skeletal muscle, kidney, liver and placenta. ATG3 as a E2-like enzyme, involves in autophagy and mitochondrial homeostasis. ATG3 catalyzes the conjugation of ATG8-like proteins to PE which is essential for autophagy. As an autocatalytic E2-like enzyme, ATG3 also can catalyzes the conjugation of ATG12 to itself which palys a role in mitochondrial homeostasis but not in autophagy.

Tested Applications: N/A
Applications: This recombinant protein can be used for biological assays. For research use only.
Predicted Molecular Weight: 35 kD
Physical state: Liquid
Buffer: Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Concentration: N/A
NCBI official symbol: ATG3
Accession #: Q9NT62
Protein GI: N/A
NCBI gene ID#: 64422
NCBI official full name: autophagy related 3
NCBI organism: Homo sapiens
Peptide sequence: MASMTGGQQMGRGSMQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHLEHHHHHH
SWISSPROT #: Q9NT62
Background Reference 1: N/A
Background Reference 2: N/A
Background Reference 3: N/A
Background Reference 4: N/A
Background Reference 5: N/A
Source: E. coli
Species: Human
By Source: E. Coli
By Species: Human
Fusion tag: C-6 His, N-T7 tag
Sequence: Met1-His287
Biology activity: N/A
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.


Size


InStock