Labprice Logo
Menu


Recombinant Schizosaccharomyces pombe Mitochondrial protein import protein mas5 (mas5)
id: LP-CSB-EP524885SXV-100ug

Labprice Recombinant Schizosaccharomyces pombe Mitochondrial protein import protein mas5 (mas5)

Cusabio

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Description: 1-404aa

MVKETKLYEVLNVDVTASQAELKKAYRKLALKYHPDKNPNAGDKFKEISRAYEILADEEKRATYDRFGEEGLQGGGADGGMSADDLFASFFGGGMFGGGMPRGPRKGKDLVHTIKVTLEDLYRGKTTKLALQKKVICPKCSGRGGKEGSVKSCASCNGSGVKFITRAMGPMIQRMQMTCPDCNGAGETIRDEDRCKECDGAKVISQRKILTVHVEKGMHNGQKIVFKEEGEQAPGIIPGDVIFVIDQKEHPRFKRSGDHLFYEAHVDLLTALAGGQIVVEHLDDRWLTIPIIPGECIRPNELKVLPGQGMLSQRHHQPGNLYIRFHVDFPEPNFATPEQLALLEKALPPRKIESAPKNAHTEECVLATVDPTEKVRIDNNVDPTTATSMDEDEDEEGGHPGVQC

Shipped on ice packs (+4°C). The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.

For research use only.


Size


InStock

Did you look for something else?


Schizosaccharomyces pombe Mitochondrial protein import protein mas5 (mas5)

Recombinant Encephalitozoon cuniculi Mitochondrial protein import protein mas5 (MAS5)

Recombinant Encephalitozoon cuniculi Mitochondrial protein import protein mas5 (MAS5)

Recombinant Encephalitozoon cuniculi Mitochondrial protein import protein mas5 (MAS5)

Recombinant Encephalitozoon cuniculi Mitochondrial protein import protein mas5 (MAS5)

Recombinant Encephalitozoon cuniculi Mitochondrial protein import protein mas5 (MAS5)

Recombinant Saccharomyces cerevisiae Mitochondrial protein import protein MAS5 (YDJ1)

Recombinant Saccharomyces cerevisiae Mitochondrial protein import protein MAS5 (YDJ1)

Recombinant Saccharomyces cerevisiae Mitochondrial protein import protein MAS5 (YDJ1)

Recombinant Saccharomyces cerevisiae Mitochondrial protein import protein MAS5 (YDJ1)

Recombinant Saccharomyces cerevisiae Mitochondrial protein import protein MAS5 (YDJ1)

mas5 Antibody

mas5 Antibody

mas5 Antibody

mas5 Antibody

Rabbit anti-Schizosaccharomyces pombe (strain 972/ATCC 24843)(Fission yeast) mas5 Polyclonal Antibody

Recombinant Schizosaccharomyces pombe Mitochondrial import protein 1 (mim1)

Recombinant Schizosaccharomyces pombe Mitochondrial import protein 1 (mim1)

Recombinant Schizosaccharomyces pombe Mitochondrial import protein 1 (mim1)

Recombinant Schizosaccharomyces pombe Mitochondrial import protein 1 (mim1), partial

Recombinant Schizosaccharomyces pombe Mitochondrial intermembrane space import and assembly protein 40 (mia40)

Recombinant Schizosaccharomyces pombe Mitochondrial intermembrane space import and assembly protein 40 (mia40)

Recombinant Schizosaccharomyces pombe Mitochondrial intermembrane space import and assembly protein 40 (mia40)

Recombinant Schizosaccharomyces pombe Mitochondrial intermembrane space import and assembly protein 40 (mia40)

Categories related to Recombinant Schizosaccharomyces pombe Mitochondrial protein import protein mas5 (mas5)

Protein