Recombinant Human herpesvirus 6B Protein U24 (U24)

id: LP-CSB-CF865554HKA-100ug

Labprice Recombinant Human herpesvirus 6B Protein U24 (U24)

Cusabio

N-terminal 10xHis-tagged

Description: 1-88aa

MDRPRTPPPSYSEVLMMDVMYGQVSPHASNDTSFVECLPPPQSSRSAWNLWNKRRKTFAFLVLTGLAIAMILFIAFVIYVFNVNRRKK

Size

InStock

Did you look for something else?

Recombinant Human herpesvirus 6B Protein U24 (U24), partial

Recombinant Human herpesvirus 6A Glycoprotein U24 (U24)

Recombinant Human herpesvirus 6A Glycoprotein U24 (U24)

Recombinant Human herpesvirus 6A Glycoprotein U24 (U24)

Recombinant Human herpesvirus 6A Glycoprotein U24 (U24), partial

Recombinant Chilobrachys jingzhao U24-theraphotoxin-Cj1a

Recombinant Chilobrachys jingzhao U24-theraphotoxin-Cj1a

Recombinant Chilobrachys jingzhao U24-theraphotoxin-Cj1a

Recombinant Chilobrachys jingzhao U24-theraphotoxin-Cj1a

Recombinant Chilobrachys jingzhao U24-theraphotoxin-Cj1a

Recombinant Phoneutria nigriventer U24-ctenitoxin-Pn1a

Recombinant Phoneutria nigriventer U24-ctenitoxin-Pn1a

Recombinant Phoneutria nigriventer U24-ctenitoxin-Pn1a

Recombinant Phoneutria nigriventer U24-ctenitoxin-Pn1a

Recombinant Phoneutria nigriventer U24-ctenitoxin-Pn1a

Recombinant Arabidopsis thaliana Glutathione S-transferase U24 (GSTU24)

Recombinant Arabidopsis thaliana Glutathione S-transferase U24 (GSTU24)

Recombinant Arabidopsis thaliana Glutathione S-transferase U24 (GSTU24)

Recombinant Arabidopsis thaliana Glutathione S-transferase U24 (GSTU24)

Recombinant Arabidopsis thaliana Glutathione S-transferase U24 (GSTU24)

Myc-DDK-tagged ORF clone of viral ORF for protein U24 [Human herpesvirus 6], codon optimized for human cell expression, NP_042917

Myc-DDK-tagged ORF clone of viral ORF for protein U24 [Human herpesvirus 7], codon optimized for human cell expression, YP_073763

Recombinant Human herpesvirus 6B Protein U22 (U22)

Categories related to Recombinant Human herpesvirus 6B Protein U24 (U24)

Protein